PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s931581g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family HSF
Protein Properties Length: 103aa    MW: 11529 Da    PI: 6.5159
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s931581g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind76.44.8e-243090262
                       HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
       HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
                       Fl+k+ye++e +e  +++sw+e+g+ fvv+ ++ef++ +Lp+yFkh nfaSF+RQLn+Y  
  PDK_30s931581g002 30 FLSKTYELVEGSEAPHVVSWNEEGTGFVVWLPQEFSQFILPRYFKHCNFASFIRQLNTYSL 90
                       9**********************************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467854.62E-212590IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.105.3E-252589IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.9E-1626102IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.5E-133053IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004479.5E-203090IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.5E-136880IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.5E-138193IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MEAGGETASA SNRPGRTPSP RGRGRSLAPF LSKTYELVEG SEAPHVVSWN EEGTGFVVWL  60
PQEFSQFILP RYFKHCNFAS FIRQLNTYSL DAQSLEGLIP VFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B3e-152890264Putative transcription factor
5d5x_B3e-152890264Putative transcription factor
5d5x_E3e-152890264Putative transcription factor
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918529.13e-51PREDICTED: heat stress transcription factor B-4b-like
SwissprotQ963203e-25HSFB1_ARATH; Heat stress transcription factor B-1
TrEMBLW1NJ128e-29W1NJ12_AMBTC; Uncharacterized protein
STRINGPOPTR_0011s05130.15e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.14e-26heat shock factor 4